Reaction Details |
| Report a problem with these data |
Target | Urokinase plasminogen activator surface receptor |
---|
Ligand | BDBM50401188 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_881708 (CHEMBL2209754) |
---|
IC50 | 11000±n/a nM |
---|
Citation | Wang, F; Eric Knabe, W; Li, L; Jo, I; Mani, T; Roehm, H; Oh, K; Li, J; Khanna, M; Meroueh, SO Design, synthesis, biochemical studies, cellular characterization, and structure-based computational studies of small molecules targeting the urokinase receptor. Bioorg Med Chem20:4760-73 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Urokinase plasminogen activator surface receptor |
---|
Name: | Urokinase plasminogen activator surface receptor |
Synonyms: | CD_antigen=CD87 | MO3 | Monocyte activation antigen Mo3 | PLAUR | U-PAR | UPAR | UPAR_HUMAN | Urokinase plasminogen activator surface receptor | Urokinase receptor (uPAR) | Urokinase-type plasminogen activator/surface receptor |
Type: | Receptor |
Mol. Mass.: | 36979.14 |
Organism: | Homo sapiens (Human) |
Description: | Q03405 |
Residue: | 335 |
Sequence: | MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
|
|
|
BDBM50401188 |
---|
n/a |
---|
Name | BDBM50401188 |
Synonyms: | CHEMBL2205796 |
Type | Small organic molecule |
Emp. Form. | C28H24N2O4 |
Mol. Mass. | 452.5012 |
SMILES | CC1CCCN(C1)c1cc(=Cc2ccc(cc2)C(O)=O)c2c(O)c3ccccc3c3onc1c23 |w:10.11| |
Structure |
|