| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50401862 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_886105 (CHEMBL2210027) |
|---|
| IC50 | 5.2±n/a nM |
|---|
| Citation |  Riganas, S; Papanastasiou, I; Foscolos, GB; Tsotinis, A; Serin, G; Mirjolet, JF; Dimas, K; Kourafalos, VN; Eleutheriades, A; Moutsos, VI; Khan, H; Georgakopoulou, S; Zaniou, A; Prassa, M; Theodoropoulou, M; Mantelas, A; Pondiki, S; Vamvakides, A New adamantane phenylalkylamines withs-receptor binding affinity and anticancer activity, associated with putative antagonism of neuropathic pain. J Med Chem55:10241-61 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50401862 |
|---|
| n/a |
|---|
| Name | BDBM50401862 |
|---|
| Synonyms: | CHEMBL2204668 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H38N2 |
|---|
| Mol. Mass. | 414.6254 |
|---|
| SMILES | CN1CCN(Cc2ccc(cc2)C(c2ccccc2)C23CC4CC(CC(C4)C2)C3)CC1 |TLB:12:19:22.21.26:24,THB:20:21:24:28.19.27,20:19:22.21.26:24,27:19:22:26.25.24,27:25:22:28.20.19,12:19:22:26.25.24| |
|---|
| Structure | 
|
|---|
Search and Browse
