Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBDNF/NT-3 growth factors receptor
LigandBDBM50402020
Substrate/Competitorn/a
Meas. Tech.ChEMBL_886723
Ki>4500±n/a nM
Citation Zhang QXia ZMitten MJLasko LMKlinghofer VBouska JJohnson EFPenning TDLuo YGiranda VLShoemaker ARStewart KDDjuric SWVasudevan A Hit to Lead optimization of a novel class of squarate-containing polo-like kinases inhibitors. Bioorg Med Chem Lett 22:7615-22 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
BDNF/NT-3 growth factors receptor
Name:Neurotrophic tyrosine kinase receptor
Synonyms:GP145-TrkB | NTRK2 | Neurotrophic tyrosine kinase receptor type 2 | TRKB | Trk-B | TrkB tyrosine kinase | Tropomyosin-related kinase B | Tropomyosin-related kinase B (TRKB) | Tyrosine kinase receptor B (Trk-B)
Type:Enzyme
Mol. Mass.:91996.87
Organism:Homo sapiens (Human)
Description:Q16620
Residue:822
Sequence:
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASP
LHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVL
KRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHI
VKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQI
AAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWM
PPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQ
EVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50402020
n/a
NameBDBM50402020
Synonyms:CHEMBL2205426
TypeSmall organic molecule
Emp. Form.C23H22N6O2
Mol. Mass.414.4598
SMILESCC(C)(C)Nc1c(Nc2ccnc(Nc3ccc(cc3)-c3ccncc3)n2)c(=O)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: