Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50402139 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_884722 (CHEMBL2215603) |
---|
Ki | 17.6±n/a nM |
---|
Citation | Fujii, H; Nakajima, R; Akiyama, J; Yamamoto, N; Hirayama, S; Nemoto, T; Gouda, H; Hirono, S; Nagase, H Synthesis of new opioid derivatives with a propellane skeleton and their pharmacologies: part 3, novel propellane derivatives with pentacyclic skeletons. Bioorg Med Chem Lett22:7697-701 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50402139 |
---|
n/a |
---|
Name | BDBM50402139 |
Synonyms: | CHEMBL2207679 |
Type | Small organic molecule |
Emp. Form. | C22H25NO2 |
Mol. Mass. | 335.4394 |
SMILES | Oc1ccc2CC34CC5C=CC3N(CC3CC3)CCC4(CC5=O)c2c1 |c:9| |
Structure |
|