| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity protein phosphatase 3 |
|---|
| Ligand | BDBM50402649 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_886799 (CHEMBL2210490) |
|---|
| IC50 | 12000±n/a nM |
|---|
| Citation |  Sarkis, M; Tran, DN; Kolb, S; Miteva, MA; Villoutreix, BO; Garbay, C; Braud, E Design and synthesis of novel bis-thiazolone derivatives as micromolar CDC25 phosphatase inhibitors: effect of dimerisation on phosphatase inhibition. Bioorg Med Chem Lett22:7345-50 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dual specificity protein phosphatase 3 |
|---|
| Name: | Dual specificity protein phosphatase 3 |
|---|
| Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 20480.58 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 185 |
|---|
| Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
|---|
| BDBM50402649 |
|---|
| n/a |
|---|
| Name | BDBM50402649 |
|---|
| Synonyms: | CHEMBL2206736 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H32N4O6S2 |
|---|
| Mol. Mass. | 644.76 |
|---|
| SMILES | OC(=O)C=Cc1ccc(C=C2SC(NCCCCCCCNC3=NC(=O)C(S3)=Cc3ccc(C=CC(O)=O)cc3)=NC2=O)cc1 |w:4.4,34.35,28.29,9.8,c:41,t:22| |
|---|
| Structure | 
|
|---|
Search and Browse
