Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
LigandBDBM50169002
Substrate/Competitorn/a
Meas. Tech.ChEMBL_885341
Ki 790±n/a nM
Citation Moorthy NSBrás NFRamos MJFernandes PA Virtual screening and QSAR study of some pyrrolidine derivatives asa-mannosidase inhibitors for binding feature analysis. Bioorg Med Chem 20:6945-59 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
Name:Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:79590.42
Organism:Homo sapiens (Human)
Description:ChEMBL_885341
Residue:699
Sequence:
MAACEGRRSGALGSSQSDFLTPPVGGAPWAVATTVVMYPPPPPPPHRDFISVTLSFGENY
DNSKSWRRRSCWRKWKQLSRLQRNMILFLLAFLLFCGLLFYINLADHWKALAFRLEEEQK
MRPEIAGLKPANPPVLPAPQKADTDPENLPEISSQKTQRHIQRGPPHLQIRPPSQDLKDG
TQEEATKRQEAPVDPRPEGDPQRTVISWRGAVIEPEQGTELPSRRAEVPTKPPLPPARTQ
GTPVHLNYRQKGVIDVFLHAWKGYRKFAWGHDELKPVSRSFSEWFGLGLTLIDALDTMWI
LGLRKEFEEARKWVSKKLHFEKDVDVNLFESTIRILGGLLSAYHLSGDSLFLRKAEDFGN
RLMPAFRTPSKIPYSDVNIGTGVAHPPRWTSDSTVAEVTSIQLEFRELSRLTGDKKFQEA
VEKVTQHIHGLSGKKDGLVPMFINTHSGLFTHLGVFTLGARADSYYEYLLKQWIQGGKQE
TQLLEDYVEAIEGVRTHLLRHSEPSKLTFVGELAHGRFSAKMDHLVCFLPGTLALGVYHG
LPASHMELAQELMETCYQMNRQMETGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPET
VESLFYLYRVTGDRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKPEPRDKMESFF
LGETLKYLFLLFSDDPNLLSLDAYVFNTEAHPLPIWTPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50169002
n/a
NameBDBM50169002
Synonyms:(2R,3R,4S)-2-[((S)-Phenyl-1-(R)-2-hydroxy-2-phenyl-ethylamino)-methyl]-pyrrolidine-3,4-diol | CHEMBL188227
TypeSmall organic molecule
Emp. Form.C19H24N2O3
Mol. Mass.328.4055
SMILESO[C@H]([C@H](NC[C@H]1NC[C@H](O)[C@@H]1O)c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: