| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50421660 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_54243 (CHEMBL668120) |
|---|
| IC50 | 800±n/a nM |
|---|
| Citation |  Roth, B; Aig, E; Lane, K; Rauckman, BS 2,4-Diamino-5-benzylpyrimidines as antibacterial agents. 4. 6-Substituted trimethoprim derivatives from phenolic Mannich intermediates. Application to the synthesis of trimethoprim and 3,5-dialkylbenzyl analogues. J Med Chem23:535-41 (1980) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 17532.46 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 157 |
|---|
| Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
|---|
| BDBM50421660 |
|---|
| n/a |
|---|
| Name | BDBM50421660 |
|---|
| Synonyms: | CHEMBL149353 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H22N4O3 |
|---|
| Mol. Mass. | 318.3709 |
|---|
| SMILES | CCCc1nc(N)nc(N)c1Cc1cc(OC)c(O)c(OC)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
