Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50405044 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_53616 |
---|
Ki | 11220±n/a nM |
---|
Citation | Hansch, C; Hathaway, BA; Guo, ZR; Selassie, CD; Dietrich, SW; Blaney, JM; Langridge, R; Volz, KW; Kaufman, BT Crystallography, quantitative structure-activity relationships, and molecular graphics in a comparative analysis of the inhibition of dihydrofolate reductase from chicken liver and Lactobacillus casei by 4,6-diamino-1,2-dihydro-2,2-dimethyl-1-(substituted-phenyl)-s-triazine s. J Med Chem27:129-43 (1984) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | 1.5.1.3 | DHFR | DYR_CHICK |
Type: | n/a |
Mol. Mass.: | 21652.69 |
Organism: | Gallus gallus (Chicken) |
Description: | n/a |
Residue: | 189 |
Sequence: | VRSLNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQNAVIMGKKTWFSI
PEKNRPLKDRINIVLSRELKEAPKGAHYLSKSLDDALALLDSPELKSKVDMVWIVGGTAV
YKAAMEKPINHRLFVTRILHEFESDTFFPEIDYKDFKLLTEYPGVPADIQEEDGIQYKFE
VYQKSVLAQ
|
|
|
BDBM50405044 |
---|
n/a |
---|
Name | BDBM50405044 |
Synonyms: | CHEMBL33571 |
Type | Small organic molecule |
Emp. Form. | C12H14N6 |
Mol. Mass. | 242.2798 |
SMILES | CC1(C)N=C(N)N=C(N)N1c1ccc(cc1)C#N |t:3,6| |
Structure |
|