Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetElastase
LigandBDBM50405199
Substrate/Competitorn/a
Meas. Tech.ChEBML_153468
Ki 1071519±n/a nM
Citation Spencer RWCopp LJPfister JR Inhibition of human leukocyte elastase, porcine pancreatic elastase, and chymotrypsin by elasnin and other 4-hydroxy-2-pyrones. J Med Chem 28:1828-32 (1986) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Elastase
Name:Pancreatic elastase
Synonyms:Elastase 1 | Elastase-1 | Pancreatic elastase
Type:Enzyme
Mol. Mass.:28827.71
Organism:Sus scrofa (Pig)
Description:P00772
Residue:266
Sequence:
MLRLLVVASLVLYGHSTQDFPETNARVVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTL
IRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDI
ALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVD
YAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGC
NVTRKPTVFTRVSAYISWINNVIASN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50405199
n/a
NameBDBM50405199
Synonyms:CHEMBL56016
TypeSmall organic molecule
Emp. Form.C18H28O5
Mol. Mass.324.4119
SMILESCCCCc1c(CC(C)O)oc(=O)c(CCCC)c1OC(C)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: