| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50405962 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_53614 |
|---|
| Ki | 19953±n/a nM |
|---|
| Citation |  Selassie, CD; Fang, ZX; Li, RL; Hansch, C; Debnath, G; Klein, TE; Langridge, R; Kaufman, BT On the structure selectivity problem in drug design. A comparative study of benzylpyrimidine inhibition of vertebrate and bacterial dihydrofolate reductase via molecular graphics and quantitative structure-activity relationships. J Med Chem32:1895-905 (1989) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | 1.5.1.3 | DHFR | DYR_CHICK |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 21652.69 |
|---|
| Organism: | Gallus gallus (Chicken) |
|---|
| Description: | n/a |
|---|
| Residue: | 189 |
|---|
| Sequence: | VRSLNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQNAVIMGKKTWFSI
PEKNRPLKDRINIVLSRELKEAPKGAHYLSKSLDDALALLDSPELKSKVDMVWIVGGTAV
YKAAMEKPINHRLFVTRILHEFESDTFFPEIDYKDFKLLTEYPGVPADIQEEDGIQYKFE
VYQKSVLAQ
|
|
|
|---|
| BDBM50405962 |
|---|
| n/a |
|---|
| Name | BDBM50405962 |
|---|
| Synonyms: | CHEMBL19772 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H11FN4 |
|---|
| Mol. Mass. | 218.2302 |
|---|
| SMILES | Nc1ncc(Cc2cccc(F)c2)c(N)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
