Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 1D |
---|
Ligand | BDBM50005835 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1959 (CHEMBL856076) |
---|
IC50 | 19.95±n/a nM |
---|
Citation | Street, LJ; Baker, R; Davey, WB; Guiblin, AR; Jelley, RA; Reeve, AJ; Routledge, H; Sternfeld, F; Watt, AP; Beer, MS Synthesis and serotonergic activity of N,N-dimethyl-2-[5-(1,2,4-triazol-1-ylmethyl)-1H-indol-3-yl]ethylamine and analogues: potent agonists for 5-HT1D receptors. J Med Chem38:1799-810 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 1D |
---|
Name: | 5-hydroxytryptamine receptor 1D |
Synonyms: | 5HT1D_PIG | HTR1D | Serotonin 1d (5-HT1d) receptor |
Type: | PROTEIN |
Mol. Mass.: | 32680.56 |
Organism: | Sus scrofa |
Description: | ChEMBL_1963 |
Residue: | 291 |
Sequence: | AMTDLLVSILVMPISIPYTITQTWSFGQLLCDIWLSSDITCCTASILHLCVIALDRYWAI
TDALEYSKRRTAGHAAAMIAIVWAISICISIPPLFWRQARAHEEISDCLVNTSQISYTIY
STCGAFYIPSLLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSL
HEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVA
SLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKVV
|
|
|
BDBM50005835 |
---|
n/a |
---|
Name | BDBM50005835 |
Synonyms: | (3-[2-(dimethylamino)ethyl]-1H-indol-5-yl)-N-methylmethanesulfonamide | 1-[3-(2-dimethylaminoethyl)-1H-indol-5-yl]-N-methyl-methanesulfonamide | 1-{3-[2-(dimethylamino)ethyl]-1H-indol-5-yl}-N-methylmethanesulfonamide | 3-(2-(dimethylamino)ethyl)-N-methyl-1H-indole-5-methanesulfonamide | 3-[2-(dimethylamino)ethyl]-N-methylindole-5-methanesulfonamide | CHEMBL128 | SUMATRIPTAN | Sumatran | Sumax |
Type | Small organic molecule |
Emp. Form. | C14H21N3O2S |
Mol. Mass. | 295.4 |
SMILES | CNS(=O)(=O)Cc1ccc2[nH]cc(CCN(C)C)c2c1 |
Structure |
|