| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1D |
|---|
| Ligand | BDBM50407361 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1961 (CHEMBL875911) |
|---|
| IC50 | 7.94±n/a nM |
|---|
| Citation |  Street, LJ; Baker, R; Davey, WB; Guiblin, AR; Jelley, RA; Reeve, AJ; Routledge, H; Sternfeld, F; Watt, AP; Beer, MS Synthesis and serotonergic activity of N,N-dimethyl-2-[5-(1,2,4-triazol-1-ylmethyl)-1H-indol-3-yl]ethylamine and analogues: potent agonists for 5-HT1D receptors. J Med Chem38:1799-810 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 1D |
|---|
| Name: | 5-hydroxytryptamine receptor 1D |
|---|
| Synonyms: | 5HT1D_PIG | HTR1D | Serotonin 1d (5-HT1d) receptor |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32680.56 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | ChEMBL_1963 |
|---|
| Residue: | 291 |
|---|
| Sequence: | AMTDLLVSILVMPISIPYTITQTWSFGQLLCDIWLSSDITCCTASILHLCVIALDRYWAI
TDALEYSKRRTAGHAAAMIAIVWAISICISIPPLFWRQARAHEEISDCLVNTSQISYTIY
STCGAFYIPSLLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSL
HEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVA
SLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKVV
|
|
|
|---|
| BDBM50407361 |
|---|
| n/a |
|---|
| Name | BDBM50407361 |
|---|
| Synonyms: | CHEMBL53764 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H20N4 |
|---|
| Mol. Mass. | 268.3568 |
|---|
| SMILES | CN(C)CCc1c[nH]c2ccc(cc12)-n1ccnc1C |
|---|
| Structure | 
|
|---|
Search and Browse
