| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein Tat |
|---|
| Ligand | BDBM50032828 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_199318 (CHEMBL805260) |
|---|
| IC50 | 4000±n/a nM |
|---|
| Citation |  Michne, WF; Schroeder, JD; Bailey, TR; Neumann, HC; Cooke, D; Young, DC; Hughes, JV; Kingsley, SD; Ryan, KA; Putz, HS Keto/enol epoxy steroids as HIV-1 Tat inhibitors: structure-activity relationships and pharmacophore localization. J Med Chem38:3197-206 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein Tat |
|---|
| Name: | Protein Tat |
|---|
| Synonyms: | Human immunodeficiency virus type 1 Tat protein | Protein Tat | TAT_HV112 | Transactivating regulatory protein | tat |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 9771.75 |
|---|
| Organism: | Human immunodeficiency virus type 1 (isolate PCV12 group M subtype B)(HIV-1) |
|---|
| Description: | ChEMBL_199318 |
|---|
| Residue: | 86 |
|---|
| Sequence: | MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAPQ
GSQTHQVSLSKQPTSQSRGDPTGPKE
|
|
|
|---|
| BDBM50032828 |
|---|
| n/a |
|---|
| Name | BDBM50032828 |
|---|
| Synonyms: | 7-Chloro-5-(1H-pyrrol-2-yl)-1,3-dihydro-benzo[e][1,4]diazepin-2-one | 7-chloro-5-(1H-pyrrol-2-yl)-1H-benzo[e][1,4]diazepin-2(3H)-one | CHEMBL91609 | Ro-5-3335 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H10ClN3O |
|---|
| Mol. Mass. | 259.691 |
|---|
| SMILES | Clc1ccc2NC(=O)CN=C(c3ccc[nH]3)c2c1 |t:9| |
|---|
| Structure | 
|
|---|
Search and Browse
