| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50029763 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_53000 (CHEMBL858265) |
|---|
| Ki | 17.38±n/a nM |
|---|
| Citation |  Marlowe, CK; Selassie, CD; Santi, DV Quantitative structure-activity relationships of the inhibition of Pneumocystis carinii dihydrofolate reductase by 4,6-diamino-1,2-dihydro-2,2-dimethyl-1-(X-phenyl)-s-triazines. J Med Chem38:967-72 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_PNECA | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23891.29 |
|---|
| Organism: | Pneumocystis carinii |
|---|
| Description: | n/a |
|---|
| Residue: | 206 |
|---|
| Sequence: | MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRK
TWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRI
FVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESW
VGTKVPHGKINEDGFDYEFEMWTRDL
|
|
|
|---|
| BDBM50029763 |
|---|
| n/a |
|---|
| Name | BDBM50029763 |
|---|
| Synonyms: | 5-(3,5-Diethoxy-4-pyrrol-1-yl-benzyl)-pyrimidine-2,4-diamine | CHEMBL280378 | Epiroprim | TCMDC-137295 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H23N5O2 |
|---|
| Mol. Mass. | 353.4182 |
|---|
| SMILES | CCOc1cc(Cc2cnc(N)nc2N)cc(OCC)c1-n1cccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
