| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50292627 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_38119 (CHEMBL650074) |
|---|
| IC50 | 285000000±n/a nM |
|---|
| Citation |  So, SS; Karplus, M Genetic neural networks for quantitative structure-activity relationships: improvements and application of benzodiazepine affinity for benzodiazepine/GABAA receptors. J Med Chem39:5246-56 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50292627 |
|---|
| n/a |
|---|
| Name | BDBM50292627 |
|---|
| Synonyms: | (RS)-9-chloro-6-(2-chlorophenyl)-4-hydroxy-2,5-diazabicyclo[5.4.0]undeca-5,8,10,12-tetraen-3-one | 7-Chloro-5-(2-chloro-phenyl)-3-hydroxy-1,3-dihydro-benzo[e][1,4]diazepin-2-one | 7-Chloro-5-(2-chloro-phenyl)-3-hydroxy-1,3-dihydro-benzo[e][1,4]diazepin-2-one (lorazepam) | 7-chloro-5-(2-chlorophenyl)-3-hydroxy-1H-benzo[e][1,4]diazepin-2(3H)-one | Ativan | CHEMBL580 | LORAZEPAM | LORAZEPAM7-Chloro-5-(2-chloro-phenyl)-3-hydroxy-1,3-dihydro-benzo[e][1,4]diazepin-2-one | Loraz | Lorazepam intensol | Lorazepam preservative free | WY-4036 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H10Cl2N2O2 |
|---|
| Mol. Mass. | 321.158 |
|---|
| SMILES | OC1N=C(c2ccccc2Cl)c2cc(Cl)ccc2NC1=O |t:2| |
|---|
| Structure | 
|
|---|
Search and Browse
