Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50005385 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_158030 (CHEMBL768621) |
---|
IC50 | 0.250035±n/a nM |
---|
Citation | Vieth, M; Cummins, DJ DoMCoSAR: a novel approach for establishing the docking mode that is consistent with the structure-activity relationship. Application to HIV-1 protease inhibitors and VEGF receptor tyrosine kinase inhibitors. J Med Chem43:3020-32 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50005385 |
---|
n/a |
---|
Name | BDBM50005385 |
Synonyms: | CHEMBL105319 |
Type | Small organic molecule |
Emp. Form. | C33H40N2O5S |
Mol. Mass. | 576.746 |
SMILES | [H][C@](O)(C[C@@]([H])(CSc1ccccc1)C(=O)N[C@]1([H])c2ccccc2C[C@@]1([H])O)[C@]([H])(Cc1ccccc1)NC(=O)OC(C)(C)C |
Structure |
|