Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase inhibitor 1 |
---|
Ligand | BDBM50410018 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_312386 (CHEMBL833769) |
---|
IC50 | >20000±n/a nM |
---|
Citation | Wang, YD; Johnson, S; Powell, D; McGinnis, JP; Miranda, M; Rabindran, SK Inhibition of tumor cell proliferation by thieno[2,3-d]pyrimidin-4(1H)-one-based analogs. Bioorg Med Chem Lett15:3763-6 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase inhibitor 1 |
---|
Name: | Cyclin-dependent kinase inhibitor 1 |
Synonyms: | CAP20 | CDK-interacting protein 1 | CDKN1 | CDKN1A | CDN1A_HUMAN | CIP1 | MDA6 | PIC1 | SDI1 | WAF1 |
Type: | PROTEIN |
Mol. Mass.: | 18123.15 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_312386 |
Residue: | 164 |
Sequence: | MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
|
|
|
BDBM50410018 |
---|
n/a |
---|
Name | BDBM50410018 |
Synonyms: | CHEMBL179187 |
Type | Small organic molecule |
Emp. Form. | C20H20ClNO3S |
Mol. Mass. | 389.896 |
SMILES | COc1cc(cc(OC)c1OC)-c1cc(Cl)c2c3CCCCc3sc2n1 |
Structure |
|