Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor subunit alpha-4
LigandBDBM50088453
Substrate/Competitorn/a
Meas. Tech.ChEMBL_562743
EC50 257.04±n/a nM
Citation Tosco PAhring PKDyhring TPeters DHarpsøe KLiljefors TBalle T Complementary three-dimensional quantitative structure-activity relationship modeling of binding affinity and functional potency: a study on alpha4beta2 nicotinic ligands. J Med Chem 52:2311-6 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor subunit alpha-4
Name:Neuronal acetylcholine receptor subunit alpha-4
Synonyms:CHRNA4 | CHRNA4 protein | NACRA4 | Neuronal acetylcholine receptor protein alpha-4 subunit | Neuronal acetylcholine receptor subunit alpha 4 beta 2 | Nicotinic acetylcholine receptor alpha4/beta2/alpha5
Type:n/a
Mol. Mass.:69963.49
Organism:Homo sapiens (Human)
Description:NACHRA4
Residue:627
Sequence:
MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISD
VVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWR
PDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFG
SWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIR
RLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTS
LVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKR
PSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGP
SCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEG
GVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSV
SPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDR
IFLWMFIIVCLLGTVGLFLPPWLAGMI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50088453
n/a
NameBDBM50088453
Synonyms:1-(6-Bromo-5-ethoxy-pyridin-3-yl)-[1,4]diazepane | 1-(6-bromo-5-ethoxypyridin-3-yl)-1,4-diazepane | CHEMBL72433 | NS3570, 5
TypeSmall organic molecule
Emp. Form.C12H18BrN3O
Mol. Mass.300.195
SMILESCCOc1cc(cnc1Br)N1CCCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: