| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50170342 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_570539 (CHEMBL1026911) |
|---|
| Ki | 82.04±n/a nM |
|---|
| Citation |  De Freitas, GB; da Silva, LL; Romeiro, NC; Fraga, CA Development of CoMFA and CoMSIA models of affinity and selectivity for indole ligands of cannabinoid CB1 and CB2 receptors. Eur J Med Chem44:2482-96 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50170342 |
|---|
| n/a |
|---|
| Name | BDBM50170342 |
|---|
| Synonyms: | 2-(2-Methoxy-phenyl)-1-(2-methyl-1-pentyl-1H-indol-3-yl)-ethanone | 2-(2-methoxyphenyl)-1-(2-methyl-1-pentyl-1H-indol-3-yl)ethanone | CHEMBL361088 | JWH-306 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H27NO2 |
|---|
| Mol. Mass. | 349.466 |
|---|
| SMILES | CCCCCn1c(C)c(C(=O)Cc2ccccc2OC)c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
