Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50415163 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_595183 (CHEMBL1040025) |
---|
Ki | 0.0891±n/a nM |
---|
Citation | Piergentili, A; Amantini, C; Del Bello, F; Giannella, M; Mattioli, L; Palmery, M; Perfumi, M; Pigini, M; Santoni, G; Tucci, P; Zotti, M; Quaglia, W Novel highly potent and selective sigma 1 receptor antagonists related to spipethiane. J Med Chem53:1261-9 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50415163 |
---|
n/a |
---|
Name | BDBM50415163 |
Synonyms: | CHEMBL571418 |
Type | Small organic molecule |
Emp. Form. | C19H21NOS |
Mol. Mass. | 311.441 |
SMILES | C(N1CCC2(CC1)OCc1ccccc1S2)c1ccccc1 |
Structure |
|