| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptide deformylase |
|---|
| Ligand | BDBM50416428 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_643979 (CHEMBL1211878) |
|---|
| IC50 | 28±n/a nM |
|---|
| Citation |  Lee, SK; Choi, KH; Lee, SJ; Suh, SW; Kim, BM; Lee, BJ Peptide deformylase inhibitors with retro-amide scaffold: synthesis and structure-activity relationships. Bioorg Med Chem Lett20:4317-9 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptide deformylase |
|---|
| Name: | Peptide deformylase |
|---|
| Synonyms: | DEF_PSEAE | PDF | Polypeptide deformylase | def |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 19357.88 |
|---|
| Organism: | Pseudomonas aeruginosa |
|---|
| Description: | ChEMBL_643979 |
|---|
| Residue: | 168 |
|---|
| Sequence: | MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVV
MDLSEDKSEPRVFINPEFEPLTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPF
EEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEKQHRQQA
|
|
|
|---|
| BDBM50416428 |
|---|
| n/a |
|---|
| Name | BDBM50416428 |
|---|
| Synonyms: | CHEMBL1209044 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H34N4O5 |
|---|
| Mol. Mass. | 398.4971 |
|---|
| SMILES | CC(C)(C)[C@H](NC(=O)N1CCOCC1)C(=O)N(CC1CCCC1)CC(=O)NO |r| |
|---|
| Structure | 
|
|---|
Search and Browse
