Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVascular adhesion protein 1 (VAP-1)
LigandBDBM50105417
Substrate/Competitorn/a
Meas. Tech.ChEMBL_659975
IC50 19.95±n/a nM
Citation Nurminen EMPihlavisto MLázár LSzakonyi ZPentikäinen UFülöp FPentikäinen OT Synthesis, in vitro activity, and three-dimensional quantitative structure-activity relationship of novel hydrazine inhibitors of human vascular adhesion protein-1. J Med Chem 53:6301-15 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vascular adhesion protein 1 (VAP-1)
Name:Vascular adhesion protein 1 (VAP-1)
Synonyms:Semicarbazide-sensitive amine oxidase (SSAO) | Semicarbazide-sensitive amine oxidase/ Vascular adhesion protein 1 (SSAO/VAP-1)
Type:Protein
Mol. Mass.:84620.86
Organism:Homo sapiens (Human)
Description:Q16853
Residue:763
Sequence:
MNQKTILVLLILAVITIFALVCVLLVGRGGDGGEPSQLPHCPSVSPSAQPWTHPGQSQLF
ADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAAALAHLDRGSPPP
AREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDID
QMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFL
HHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSW
SLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPRIFDVRFQGERLV
YEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQ
APKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFH
PSGAIEIRFYATGYISSAFLFGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVW
AEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHP
RGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDF
SDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSA
DSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSHN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50105417
n/a
NameBDBM50105417
Synonyms:CHEMBL1089 | Nardil | PHENELZINE | Phenethyl-hydrazine
TypeSmall organic molecule
Emp. Form.C8H12N2
Mol. Mass.136.1943
SMILESNNCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: