Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 2B4
LigandBDBM50027780
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774153
Ki 37000±n/a nM
Citation Fontana EDansette PMPoli SM Cytochrome p450 enzymes mechanism based inhibitors: common sub-structures and reactivity. Curr Drug Metab 6:413-54 (2005) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 2B4
Name:Cytochrome P450 2B4
Synonyms:CYP2B4 | CYPIIB4 | Cytochrome P450 LM2 | Cytochrome P450 isozyme 2 | Cytochrome P450 type B0 | Cytochrome P450 type B1
Type:PROTEIN
Mol. Mass.:55725.83
Organism:Oryctolagus cuniculus
Description:ChEMBL_774153
Residue:491
Sequence:
MEFSLLLLLAFLAGLLLLLFRGHPKAHGRLPPGPSPLPVLGNLLQMDRKGLLRSFLRLRE
KYGDVFTVYLGSRPVVVLCGTDAIREALVDQAEAFSGRGKIAVVDPIFQGYGVIFANGER
WRALRRFSLATMRDFGMGKRSVEERIQEEARCLVEELRKSKGALLDNTLLFHSITSNIIC
SIVFGKRFDYKDPVFLRLLDLFFQSFSLISSFSSQVFELFPGFLKHFPGTHRQIYRNLQE
INTFIGQSVEKHRATLDPSNPRDFIDVYLLRMEKDKSDPSSEFHHQNLILTVLSLFFAGT
ETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDDRAKMPYTDAVIHEIQRLG
DLIPFGVPHTVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFLDANGAL
KRNEGFMPFSLGKRICLGEGIARTELFLFFTTILQNFSIASPVPPEDIDLTPRESGVGNV
PPSYQIRFLAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027780
n/a
NameBDBM50027780
Synonyms:CHEMBL1908229
TypeSmall organic molecule
Emp. Form.C8H14O
Mol. Mass.126.1962
SMILESCC(OC(C)(C)C)C#C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: