| Reaction Details |
|---|
 | Report a problem with these data |
| Target | B1 bradykinin receptor |
|---|
| Ligand | BDBM50419906 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_806223 (CHEMBL1958764) |
|---|
| Ki | >10000±n/a nM |
|---|
| Citation |  Fincham, CI; Bressan, A; D'Andrea, P; Ettorre, A; Giuliani, S; Mauro, S; Meini, S; Paris, M; Quartara, L; Rossi, C; Squarcia, A; Valenti, C; Daniela, F; Maggi, CA Design and synthesis of novel sulfonamide-containing bradykinin hB(2) receptor antagonists. Synthesis and structure-relationships ofa,a-tetrahydropyranylglycine. Bioorg Med Chem20:2091-100 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| B1 bradykinin receptor |
|---|
| Name: | B1 bradykinin receptor |
|---|
| Synonyms: | B1 BRADYKININ | B1 bradykinin receptor | B1R | BDKRB1 | BK-1 receptor | BKRB1_HUMAN | BRADYB1 | Bradykinin B1 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40508.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P46663 |
|---|
| Residue: | 353 |
|---|
| Sequence: | MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
|
|
|
|---|
| BDBM50419906 |
|---|
| n/a |
|---|
| Name | BDBM50419906 |
|---|
| Synonyms: | CHEMBL1956854 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H41Cl2N5O6S |
|---|
| Mol. Mass. | 706.68 |
|---|
| SMILES | Cc1cc(C)c2cccc(OCc3c(Cl)ccc(c3Cl)S(=O)(=O)NC3(CCOCC3)C(=O)N3CCN(CC3)C(=O)CCCCN)c2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
