Reaction Details |
| Report a problem with these data |
Target | Ileal sodium/bile acid cotransporter |
---|
Ligand | BDBM50375594 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_838471 (CHEMBL2076042) |
---|
Ki | 41500±n/a nM |
---|
Citation | Craddock, AL; Love, MW; Daniel, RW; Kirby, LC; Walters, HC; Wong, MH; Dawson, PA Expression and transport properties of the human ileal and renal sodium-dependent bile acid transporter. Am J Physiol274:157-69 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ileal sodium/bile acid cotransporter |
---|
Name: | Ileal sodium/bile acid cotransporter |
Synonyms: | ASBT | Apical sodium-dependent bile acid transporter | IBAT | ISBT | Ileal Na(+)/bile acid cotransporter | Ileal bile acid transporter | Ileal bile acid transporter/bile acid cotransporter | Ileal sodium-dependent bile acid transporter | NTCP2 | NTCP2_HUMAN | SLC10A2 |
Type: | Enzyme |
Mol. Mass.: | 37714.89 |
Organism: | Homo sapiens (Human) |
Description: | SLC10A2 |
Residue: | 348 |
Sequence: | MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLG
HIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVD
GDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGM
FVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIAPKLWIIGTIFPVAGYSL
GFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQLAF
AAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK
|
|
|
BDBM50375594 |
---|
n/a |
---|
Name | BDBM50375594 |
Synonyms: | TAUROCHOLATE |
Type | Small organic molecule |
Emp. Form. | C26H45NO7S |
Mol. Mass. | 515.703 |
SMILES | C[C@H](CCC(=O)NCCS(O)(=O)=O)[C@H]1CC[C@H]2[C@@H]3[C@H](O)C[C@@H]4C[C@H](O)CC[C@]4(C)[C@H]3C[C@H](O)[C@]12C |r| |
Structure |
|