| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ileal sodium/bile acid cotransporter |
|---|
| Ligand | BDBM50375594 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_838471 (CHEMBL2076042) |
|---|
| Ki | 41500±n/a nM |
|---|
| Citation |  Craddock, AL; Love, MW; Daniel, RW; Kirby, LC; Walters, HC; Wong, MH; Dawson, PA Expression and transport properties of the human ileal and renal sodium-dependent bile acid transporter. Am J Physiol274:157-69 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ileal sodium/bile acid cotransporter |
|---|
| Name: | Ileal sodium/bile acid cotransporter |
|---|
| Synonyms: | ASBT | Apical sodium-dependent bile acid transporter | IBAT | ISBT | Ileal Na(+)/bile acid cotransporter | Ileal bile acid transporter | Ileal bile acid transporter/bile acid cotransporter | Ileal sodium-dependent bile acid transporter | NTCP2 | NTCP2_HUMAN | SLC10A2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 37714.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | SLC10A2 |
|---|
| Residue: | 348 |
|---|
| Sequence: | MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLG
HIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVD
GDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGM
FVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIAPKLWIIGTIFPVAGYSL
GFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQLAF
AAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK
|
|
|
|---|
| BDBM50375594 |
|---|
| n/a |
|---|
| Name | BDBM50375594 |
|---|
| Synonyms: | TAUROCHOLATE |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H45NO7S |
|---|
| Mol. Mass. | 515.703 |
|---|
| SMILES | C[C@H](CCC(=O)NCCS(O)(=O)=O)[C@H]1CC[C@H]2[C@@H]3[C@H](O)C[C@@H]4C[C@H](O)CC[C@]4(C)[C@H]3C[C@H](O)[C@]12C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
