| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50455442 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_158029 (CHEMBL877854) |
|---|
| IC50 | 162±n/a nM |
|---|
| Citation |  Pérez, C; Pastor, M; Ortiz, AR; Gago, F Comparative binding energy analysis of HIV-1 protease inhibitors: incorporation of solvent effects and validation as a powerful tool in receptor-based drug design. J Med Chem41:836-52 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50455442 |
|---|
| n/a |
|---|
| Name | BDBM50455442 |
|---|
| Synonyms: | CHEMBL2367848 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H40N2O6 |
|---|
| Mol. Mass. | 512.6377 |
|---|
| SMILES | [H][C@](O)(C[C@@]([H])(Cc1ccccc1)C(=O)N[C@@]([H])(C(C)C)C(O)=O)[C@]([H])(Cc1ccccc1)NC(=O)OC(C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
