| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thioredoxin |
|---|
| Ligand | BDBM50426071 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_934906 (CHEMBL2319792) |
|---|
| IC50 | 2110±n/a nM |
|---|
| Citation |  DiRaimondo, TR; Plugis, NM; Jin, X; Khosla, C Selective inhibition of extracellular thioredoxin by asymmetric disulfides. J Med Chem56:1301-10 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Thioredoxin |
|---|
| Name: | Thioredoxin |
|---|
| Synonyms: | ADF | ATL-derived factor | SASP | Surface-associated sulphydryl protein | THIO_HUMAN | TRDX | TRX | TRX1 | TXN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11732.84 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_934906 |
|---|
| Residue: | 105 |
|---|
| Sequence: | MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
|
|
|
|---|
| BDBM50426071 |
|---|
| n/a |
|---|
| Name | BDBM50426071 |
|---|
| Synonyms: | CHEMBL406050 | PX-12 | US9018255, PX-12 | med.21724, Compound 156 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C7H12N2S2 |
|---|
| Mol. Mass. | 188.314 |
|---|
| SMILES | CCC(C)SSc1ncc[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
