Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual-specificity tyrosine-phosphorylation regulated kinase 2
LigandBDBM50426338
Substrate/Competitorn/a
Meas. Tech.ChEMBL_939729
IC50 220±n/a nM
Citation Myrianthopoulos VKritsanida MGaboriaud-Kolar NMagiatis PFerandin YDurieu ELozach OCappel DSoundararajan MFilippakopoulos PSherman WKnapp SMeijer LMikros ESkaltsounis AL Novel Inverse Binding Mode of Indirubin Derivatives Yields Improved Selectivity for DYRK Kinases. ACS Med Chem Lett 4:22-26 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual-specificity tyrosine-phosphorylation regulated kinase 2
Name:Dual-specificity tyrosine-phosphorylation regulated kinase 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:66690.69
Organism:Homo sapiens (Human)
Description:ChEMBL_1508025
Residue:601
Sequence:
MLTRKPSAAAPAAYPTGRGGDSAVRQLQASPGLGAGATRSGVGTGPPSPIALPPLRASNA
AAAAHTIGGSKHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLP
VVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPE
IYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAY
DHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMT
FELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQG
RSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYP
LLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGG
RSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLP
KPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLV
S
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50426338
n/a
NameBDBM50426338
Synonyms:CHEMBL2321958
TypeSmall organic molecule
Emp. Form.C18H12BrN3O4
Mol. Mass.414.21
SMILESCN1C(=O)C(c2cccc(Br)c12)c1[nH]c2ccc(cc2c1N=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: