Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50429209 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_945637 (CHEMBL2344971) |
---|
Ki | 33±n/a nM |
---|
Citation | Fukaya, T; Kodo, T; Ishiyama, T; Nishikawa, H; Baba, S; Masumoto, S Design, synthesis and structure-activity relationship of novel tricyclic benzimidazolone derivatives as potent 18 kDa translocator protein (TSPO) ligands. Bioorg Med Chem21:1257-67 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50429209 |
---|
n/a |
---|
Name | BDBM50429209 |
Synonyms: | CHEMBL2331873 |
Type | Small organic molecule |
Emp. Form. | C24H21N3O2 |
Mol. Mass. | 383.4424 |
SMILES | O=C(Cn1c2cc(cc3CCCn(c23)c1=O)-c1ccccc1)Nc1ccccc1 |
Structure |
|