| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50431039 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_947846 (CHEMBL2343122) |
|---|
| Ki | 536±n/a nM |
|---|
| Citation |  Díaz, JL; Christmann, U; Fernández, A; Luengo, M; Bordas, M; Enrech, R; Carro, M; Pascual, R; Burgueño, J; Merlos, M; Benet-Buchholz, J; Cerón-Bertran, J; Ramírez, J; Reinoso, RF; Fernández de Henestrosa, AR; Vela, JM; Almansa, C Synthesis and biological evaluation of a new series of hexahydro-2H-pyrano[3,2-c]quinolines as novel selectives1 receptor ligands. J Med Chem56:3656-65 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50431039 |
|---|
| n/a |
|---|
| Name | BDBM50431039 |
|---|
| Synonyms: | CHEMBL2338344 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H34N2O2 |
|---|
| Mol. Mass. | 358.5176 |
|---|
| SMILES | CC(C)CCOc1ccc2N[C@H](C3CCNCC3)[C@@H]3CCCO[C@@H]3c2c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
