| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Corticotropin-releasing factor receptor 1 |
|---|
| Ligand | BDBM50432107 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_950616 (CHEMBL2352366) |
|---|
| IC50 | 7.4±n/a nM |
|---|
| Citation |  Denhart, DJ; Zuev, D; Ditta, JL; Hartz, RA; Ahuja, VT; Mattson, RJ; Huang, H; Mattson, GK; Zueva, L; Nielsen, JM; Kozlowski, ES; Lodge, NJ; Bronson, JJ; Macor, JE Potential CRF1R PET imaging agents: 1-fluoroalkylsubstituted 5-halo-3-(arylamino)pyrazin-2(1H)-ones. Bioorg Med Chem Lett23:2052-5 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Corticotropin-releasing factor receptor 1 |
|---|
| Name: | Corticotropin-releasing factor receptor 1 |
|---|
| Synonyms: | CRF-R | CRF1 | CRFR1_RAT | CRH-R 1 | Corticotropin releasing factor receptor | Corticotropin releasing factor receptor 1 | Corticotropin-releasing Factor Receptor 1 | Corticotropin-releasing hormone receptor 1 | Crhr | Crhr1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 47870.75 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Receptor binding assays were performed using rat cortex homogenate. |
|---|
| Residue: | 415 |
|---|
| Sequence: | MGRRPQLRLVKALLLLGLNPVSTSLQDQRCENLSLTSNVSGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEV
HQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPF
PIIVAWAIGKLHYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
|
|
|
|---|
| BDBM50432107 |
|---|
| n/a |
|---|
| Name | BDBM50432107 |
|---|
| Synonyms: | CHEMBL2349565 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H22ClFN4O2 |
|---|
| Mol. Mass. | 404.866 |
|---|
| SMILES | Cc1cc(cc(C)c1Nc1nc(Cl)cn([C@@H](COCCF)C2CC2)c1=O)C#N |r| |
|---|
| Structure | 
|
|---|
Search and Browse
