Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50432729
Substrate/Competitorn/a
Meas. Tech.ChEMBL_952584
Ki 20±n/a nM
Citation Thakur GABajaj SParonis CPeng YBowman ALBarak LSCaron MGParrish DDeschamps JRMakriyannis A Novel adamantyl cannabinoids as CB1 receptor probes. J Med Chem 56:3904-21 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CNR2 | Cannabinoid CB2 receptor | Cannabinoid receptor | mCB2
Type:Enzyme Catalytic Domain
Mol. Mass.:38220.43
Organism:MOUSE
Description:P47936
Residue:347
Sequence:
MEGCRETEVTNGSNGGLEFNPMKEYMILSSGQQIAVAVLCTLMGLLSALENMAVLYIILS
SRRLRRKPSYLFISSLAGADFLASVIFACNFVIFHVFHGVDSNAIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALCVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHRHVATLAEHQDRQVPGIARMRLD
VRLAKTLGLVLAVLLICWFPALALMGHSLVTTLSDQVKEAFAFCSMLCLVNSMVNPIIYA
LRSGEIRSAAQHCLIGWKKYLQGLGPEGKEEGPRSSVTETEADVKTT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50432729
n/a
NameBDBM50432729
Synonyms:CHEMBL2348460
TypeSmall organic molecule
Emp. Form.C26H34O3
Mol. Mass.394.5464
SMILESCC1(C)Oc2cc(cc(O)c2[C@@H]2C[C@H](CC[C@@H]12)C=O)C12CC3CC(CC(C3)C1)C2 |r,THB:24:23:20:26.25.27,24:25:22.23.28:20,27:25:22:28.19.20,27:19:22:26.24.25|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: