Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM18050 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_956187 (CHEMBL2379281) |
---|
IC50 | 80±n/a nM |
---|
Citation | Al-Omary, FA; Hassan, GS; El-Messery, SM; Nagi, MN; Habib, el-SE; El-Subbagh, HI Nonclassical antifolates, part 3: synthesis, biological evaluation and molecular modeling study of some new 2-heteroarylthio-quinazolin-4-ones. Eur J Med Chem63:33-45 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DHFR | DYR_BOVIN | Dihydrofolate reductase | Dihydrofolate reductase (DHFR) |
Type: | Enzyme |
Mol. Mass.: | 21603.71 |
Organism: | Bos taurus (Cattle) |
Description: | P00376 |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFQYFQRMTTVSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPKGAHFLAKSLDDALELIEDPELTNKVDVVWIVGGSS
VYKEAMNKPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLPEYPGVPLDVQEEKGIKYKF
EVYEKNN
|
|
|
BDBM18050 |
---|
n/a |
---|
Name | BDBM18050 |
Synonyms: | 2-[(4-{[(2,4-diaminopteridin-6-yl)methyl](methyl)amino}phenyl)formamido]pentanedioic acid | CHEMBL34259 | MTX | Methotrexate | cid_126941 |
Type | Small organic molecule |
Emp. Form. | C20H22N8O5 |
Mol. Mass. | 454.4393 |
SMILES | CN(Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)N[C@@H](CCC(O)=O)C(O)=O |r| |
Structure |
|