Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50435867 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_963768 (CHEMBL2395767) |
---|
Ki | 13±n/a nM |
---|
Citation | Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A Synthesis and receptor binding studies of novel 4,4-disubstituted arylalkyl/arylalkylsulfonyl piperazine and piperidine-based derivatives as a new class ofs1 ligands. Eur J Med Chem64:488-97 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50435867 |
---|
n/a |
---|
Name | BDBM50435867 |
Synonyms: | CHEMBL1479800 |
Type | Small organic molecule |
Emp. Form. | C18H21BrN2O2S |
Mol. Mass. | 409.341 |
SMILES | Brc1ccc(CN2CCN(CC2)S(=O)(=O)Cc2ccccc2)cc1 |
Structure |
|