| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Ligand | BDBM50436718 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_966861 (CHEMBL2401005) |
|---|
| IC50 | 8000±n/a nM |
|---|
| Citation |  Hu, X; Compton, JR; Abdulhameed, MD; Marchand, CL; Robertson, KL; Leary, DH; Jadhav, A; Hershfield, JR; Wallqvist, A; Friedlander, AM; Legler, PM 3-substituted indole inhibitors against Francisella tularensis FabI identified by structure-based virtual screening. J Med Chem56:5275-87 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Synonyms: | fabI |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27804.42 |
|---|
| Organism: | Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) |
|---|
| Description: | Q5NGQ3 |
|---|
| Residue: | 260 |
|---|
| Sequence: | MGFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVL
PCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISA
YSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGED
GIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGI
TGEVVHVDAGYHCVSMGNVL
|
|
|
|---|
| BDBM50436718 |
|---|
| n/a |
|---|
| Name | BDBM50436718 |
|---|
| Synonyms: | CHEMBL1341978 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H34N4O4S |
|---|
| Mol. Mass. | 486.627 |
|---|
| SMILES | O=C(CC1CCCCC1)N1CCC(CC1)c1nc(no1)-c1ccc(cc1)S(=O)(=O)N1CCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
