| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50438565 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_977137 (CHEMBL2416695) |
|---|
| Ki | >10000±n/a nM |
|---|
| Citation |  Majo, VJ; Milak, MS; Prabhakaran, J; Mali, P; Savenkova, L; Simpson, NR; Mann, JJ; Parsey, RV; Kumar, JS Synthesis and in vivo evaluation of [(18)F]2-(4-(4-(2-(2-fluoroethoxy)phenyl)piperazin-1-yl)butyl)-4-methyl-1,2,4-triazine-3,5(2H,4H)-dione ([(18)F]FECUMI-101) as an imaging probe for 5-HT1A receptor agonist in nonhuman primates. Bioorg Med Chem21:5598-604 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50438565 |
|---|
| n/a |
|---|
| Name | BDBM50438565 |
|---|
| Synonyms: | CHEMBL2413153 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H28FN5O3 |
|---|
| Mol. Mass. | 405.4664 |
|---|
| SMILES | Cn1c(=O)cnn(CCCCN2CCN(CC2)c2ccccc2OCCF)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
