Reaction Details |
| Report a problem with these data |
Target | Heme oxygenase 1 |
---|
Ligand | BDBM50438663 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_976175 (CHEMBL2415824) |
---|
IC50 | >100000±n/a nM |
---|
Citation | Salerno, L; Pittalà, V; Romeo, G; Modica, MN; Siracusa, MA; Di Giacomo, C; Acquaviva, R; Barbagallo, I; Tibullo, D; Sorrenti, V Evaluation of novel aryloxyalkyl derivatives of imidazole and 1,2,4-triazole as heme oxygenase-1 (HO-1) inhibitors and their antitumor properties. Bioorg Med Chem21:5145-53 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Heme oxygenase 1 |
---|
Name: | Heme oxygenase 1 |
Synonyms: | HMOX1_RAT | HSP32 | Heme Oxygenase 1 (HO-1) | Heme oxygenase 1 | Hmox1 |
Type: | Enzyme |
Mol. Mass.: | 33005.15 |
Organism: | Rattus norvegicus (rat) |
Description: | HO-1 obtained from rat spleen was used in enzyme assays. |
Residue: | 289 |
Sequence: | MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTA
LEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHE
VGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQ
LYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRP
ASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
|
|
|
BDBM50438663 |
---|
n/a |
---|
Name | BDBM50438663 |
Synonyms: | CHEMBL1452451 |
Type | Small organic molecule |
Emp. Form. | C11H12N4O3 |
Mol. Mass. | 248.238 |
SMILES | [O-][N+](=O)c1ccc(OCCCn2cncn2)cc1 |
Structure |
|