Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-activated inward rectifier potassium channel 4
LigandBDBM50439405
Substrate/Competitorn/a
Meas. Tech.ChEMBL_980167
EC50 1600±n/a nM
Citation Ramos-Hunter SJEngers DWKaufmann KDu YLindsley CWWeaver CDSulikowski GA Discovery and SAR of a novel series of GIRK1/2 and GIRK1/4 activators. Bioorg Med Chem Lett 23:5195-8 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G protein-activated inward rectifier potassium channel 4
Name:G protein-activated inward rectifier potassium channel 4
Synonyms:CIR | Cardiac inward rectifier | GIRK-4 | GIRK4 | Heart KATP channel | IRK-4 | Inward rectifier K(+) channel Kir3.4 | KATP-1 | KCNJ5 | Potassium channel, inwardly rectifying subfamily J member 5
Type:PROTEIN
Mol. Mass.:47658.06
Organism:Homo sapiens (Human)
Description:ChEMBL_107914
Residue:419
Sequence:
MAGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDH
VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINQKSPFWEMSQAQLHQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50439405
n/a
NameBDBM50439405
Synonyms:CHEMBL2420538
TypeSmall organic molecule
Emp. Form.C16H17ClN2O3S
Mol. Mass.352.836
SMILESCN(C)S(=O)(=O)c1cccc(NC(=O)Cc2ccccc2Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: