Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-Dependent Kinase 5 (CDK5)
LigandBDBM6866
Substrate/Competitorn/a
Meas. Tech.ChEMBL_979933
IC50 13±n/a nM
Citation Gao CCahya SNicolaou CAWang JWatson IACummins DJIversen PWVieth M Selectivity data: assessment, predictions, concordance, and implications. J Med Chem 56:6991-7002 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-Dependent Kinase 5 (CDK5)
Name:Cyclin-T1/Cyclin-dependent-like kinase 5
Synonyms:CDK5 | Cyclin-dependent kinase 5 (CDK5/ p25) | Cyclin-dependent kinase 5 (CDK5/p35) | Cyclin-dependent-like kinase 5 (CDK5)
Type:Enzyme Subunit
Mol. Mass.:33308.61
Organism:Homo sapiens (Human)
Description:n/a
Residue:292
Sequence:
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM6866
n/a
NameBDBM6866
Synonyms:1-Acyl-1H-[1,2,4]triazole-3,5-diamine Analogue 3b | 4-({5-amino-1-[(2,6-difluorophenyl)carbonyl]-1H-1,2,4-triazol-3-yl}amino)benzene-1-sulfonamide | 4-[[5-Amino-1-(2,6-difluorobenzoyl)-1H-1,2,4-triazol-3-yl]amino]-benzenesulfonamide | CHEMBL191003 | JNJ-7706621 | cid_5330790
TypeSmall organic molecule
Emp. Form.C15H12F2N6O3S
Mol. Mass.394.356
SMILESNc1nc(Nc2ccc(cc2)S(N)(=O)=O)nn1C(=O)c1c(F)cccc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: