| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Heme oxygenase 1 |
|---|
| Ligand | BDBM50441443 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_988012 (CHEMBL2438670) |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  Vlahakis, JZ; Vukomanovic, D; Nakatsu, K; Szarek, WA Selective inhibition of heme oxygenase-2 activity by analogs of 1-(4-chlorobenzyl)-2-(pyrrolidin-1-ylmethyl)-1H-benzimidazole (clemizole): Exploration of the effects of substituents at the N-1 position. Bioorg Med Chem21:6788-95 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Heme oxygenase 1 |
|---|
| Name: | Heme oxygenase 1 |
|---|
| Synonyms: | HMOX1_RAT | HSP32 | Heme Oxygenase 1 (HO-1) | Heme oxygenase 1 | Hmox1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 33005.15 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | HO-1 obtained from rat spleen was used in enzyme assays. |
|---|
| Residue: | 289 |
|---|
| Sequence: | MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTA
LEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHE
VGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQ
LYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRP
ASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
|
|
|
|---|
| BDBM50441443 |
|---|
| n/a |
|---|
| Name | BDBM50441443 |
|---|
| Synonyms: | CHEMBL2436288 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H23N3 |
|---|
| Mol. Mass. | 305.4167 |
|---|
| SMILES | Cc1cccc(Cn2c(CN3CCCC3)nc3ccccc23)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
