Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase kinase kinase 11
LigandBDBM50441567
Substrate/Competitorn/a
Meas. Tech.ChEMBL_986642
IC50 460±n/a nM
Citation Goodfellow VSLoweth CJRavula SBWiemann TNguyen TXu YTodd DESheppard DPollack SPolesskaya OMarker DFDewhurst SGelbard HA Discovery, synthesis, and characterization of an orally bioavailable, brain penetrant inhibitor of mixed lineage kinase 3. J Med Chem 56:8032-48 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase kinase kinase 11
Name:Mitogen-activated protein kinase kinase kinase 11
Synonyms:Map3k11 | Mixed lineage kinase 3 | Mlk3
Type:PROTEIN
Mol. Mass.:93237.89
Organism:Mus musculus
Description:ChEMBL_107667
Residue:850
Sequence:
MEPLKNLFLKSPLGSWNGSGSGGGGGTGGVRPEGSPKATAAYANPVWTALFDYEPNGQDE
LALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPCEVASFQELRL
EEVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIAL
KAVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIH
RDLKSNNILLLQPIEGDDMEHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTF
SKGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCW
AQDPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKEKELLS
REEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFK
RSKLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGAGDSPTFPRFRAIQLEPTE
SGQTWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRMDEATWYLDSDDSSP
LGSPSTPPALNGNPPRPSPEPEEPRRAGPTERGNSSGTPKLIQRALLRGTALLASLGLGR
DLQPPGGLSRERGESPTAPPPAQMPSPCPPELPSTPLIRLSQTTPDAHSSPTPGPLLLDL
GVPSGQPSAKSPRREETRGRTVSPPPGISRSAPGTPGTPRSPPLGLISRPRPSPLRSRID
PWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFRGGSQDCRTQTKDMGA
QAPWAPEAGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50441567
n/a
NameBDBM50441567
Synonyms:CHEMBL2436978
TypeSmall organic molecule
Emp. Form.C27H27N5
Mol. Mass.421.5368
SMILESCN1CCN(Cc2ccc(cc2)-c2cnc3[nH]cc(-c4ccc5[nH]ccc5c4)c3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: