Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase II alpha/beta
LigandBDBM50442757
Substrate/Competitorn/a
Meas. Tech.ChEMBL_989485
IC50>10.0±n/a nM
Citation Brasca MGMantegani SAmboldi NBindi SCaronni DCasale ECeccarelli WColombo NDe Ponti ADonati DErmoli AFachin GFelder ERFerguson RDFiorelli CGuanci MIsacchi APesenti EPolucci PRiceputi LSola FVisco CZuccotto FFogliatto G Discovery of NMS-E973 as novel, selective and potent inhibitor of heat shock protein 90 (Hsp90). Bioorg Med Chem 21:7047-63 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase II alpha/beta
Name:Casein kinase II alpha/beta
Synonyms:Casein kinase 2 (CK2) | Casein kinase II subunit alpha alpha beta beta | Complex of catalytic (CK2α) and non-catalytic (CK2β) subunits
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 989485
Components:This complex has 2 components.
Component 1
Name:Casein kinase II alpha
Synonyms:CK II | CK2 | CK2- alpha | CK2A1 | CSNK2A1 | Casein kinase II (CK2) | Casein kinase II alpha/beta | Casein kinase II subunit alpha | Casein kinase II subunit alpha (CK2 alpha) | Casein kinase II subunit alpha (CK2A1) | Casein kinase II subunit alpha (CK2a I174A) | Casein kinase II subunit alpha (CK2a V66A) | Casein kinase II subunit alpha (CK2a dm V66I174AA) | Casein kinase II subunit alpha (CK2a) | Casein kinase II subunit alpha (CK2α)
Type:Enzyme
Mol. Mass.:45151.12
Organism:Homo sapiens (Human)
Description:P68400
Residue:391
Sequence:
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Casein kinase II beta
Synonyms:CK II beta | Casein kinase II subunit beta | Phosvitin
Type:PROTEIN
Mol. Mass.:24937.13
Organism:Rattus norvegicus
Description:EBI_10969
Residue:215
Sequence:
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA
NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50442757
n/a
NameBDBM50442757
Synonyms:CHEMBL2443026
TypeSmall organic molecule
Emp. Form.C31H38N4O7
Mol. Mass.578.656
SMILESCN(C)c1ccc(Oc2cc(O)cc(O)c2-c2cc(no2)C(=O)NC2CCN(CC2)C2CCC3(CC2)OCCO3)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: