Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase pim-1 |
---|
Ligand | BDBM50442760 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_989456 (CHEMBL2443983) |
---|
IC50 | >10.0±n/a nM |
---|
Citation | Brasca, MG; Mantegani, S; Amboldi, N; Bindi, S; Caronni, D; Casale, E; Ceccarelli, W; Colombo, N; De Ponti, A; Donati, D; Ermoli, A; Fachin, G; Felder, ER; Ferguson, RD; Fiorelli, C; Guanci, M; Isacchi, A; Pesenti, E; Polucci, P; Riceputi, L; Sola, F; Visco, C; Zuccotto, F; Fogliatto, G Discovery of NMS-E973 as novel, selective and potent inhibitor of heat shock protein 90 (Hsp90). Bioorg Med Chem21:7047-63 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase pim-1 |
---|
Name: | Serine/threonine-protein kinase pim-1 |
Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
Type: | Protein |
Mol. Mass.: | 35681.82 |
Organism: | Homo sapiens (Human) |
Description: | P11309 |
Residue: | 313 |
Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
BDBM50442760 |
---|
n/a |
---|
Name | BDBM50442760 |
Synonyms: | CHEMBL2443044 |
Type | Small organic molecule |
Emp. Form. | C22H22N4O7 |
Mol. Mass. | 454.4327 |
SMILES | CN1CCC(CC1)NC(=O)c1cc(on1)-c1c(O)cc(O)cc1Oc1ccc(cc1)[N+]([O-])=O |
Structure |
|