| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neutrophil elastase |
|---|
| Ligand | BDBM50326055 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_990378 (CHEMBL2446014) |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  Bondada, L; Rondla, R; Pradere, U; Liu, P; Li, C; Bobeck, D; McBrayer, T; Tharnish, P; Courcambeck, J; Halfon, P; Whitaker, T; Amblard, F; Coats, SJ; Schinazi, RF Azetidines and spiro azetidines as novel P2 units in hepatitis C virus NS3 protease inhibitors. Bioorg Med Chem Lett23:6325-30 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Neutrophil elastase |
|---|
| Name: | Neutrophil elastase |
|---|
| Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28532.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P08246 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
|---|
| BDBM50326055 |
|---|
| n/a |
|---|
| Name | BDBM50326055 |
|---|
| Synonyms: | (1R,21S,24S)-21-tert-Butyl-N-((1R,2R)-1-{[(cyclopropylsulfonyl)amino]carbonyl}-2-ethylcyclopropyl)-16,16-dimethyl-3,19,22-trioxo-2,18-dioxa-4,20,23-triazatetracyclo[21.2.1.14,7.06,11]-heptacosa-6,8,10-triene-24-carboxamide | (1R,21S,24S)-21-tert-butyl-N-((1R,2R)-1-{[(cyclopropylsulfonyl)amino]carbonyl}-2-ethylcyclopropyl)-16,16-dimethyl-3,19,22-trioxo-2,18-dioxa-4,20,23-triazatetracyclo[21.2.1.14,70.06,11]heptacosa-6,8,10-triene-24-carboxamide | CHEMBL599872 | MK-7009 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H53N5O9S |
|---|
| Mol. Mass. | 755.921 |
|---|
| SMILES | CC(C)(C)[C@@H]1NC(=O)OCC(C)(C)CCCCc2cccc3CN(Cc23)C(=O)O[C@@H]2C[C@H](N(C2)C1=O)C(=O)N[C@@]1(C[C@H]1C=C)C(=O)NS(=O)(=O)C1CC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
