Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMineralocorticoid receptor
LigandBDBM50444204
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1277675
IC50 260±n/a nM
Citation Kuzmich DBentzien JBetageri RDiSalvo DFadra-Khan THarcken CKukulka ANabozny GNelson RPack ESouza DThomson D Function-regulating pharmacophores in a sulfonamide class of glucocorticoid receptor agonists. Bioorg Med Chem Lett 23:6640-4 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mineralocorticoid receptor
Name:Mineralocorticoid receptor
Synonyms:MCR | MLR | MR | NR3C2 | Nuclear receptor subfamily 3 group C member 2
Type:Enzyme
Mol. Mass.:107076.42
Organism:Homo sapiens (Human)
Description:P08235
Residue:984
Sequence:
METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSCVSGAIPNNST
QGSSKEKQELLPCLQQDNNRPGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYE
QQNQQGSMSPAKIYQNVEQLVKFYKGNGHRPSTLSCVNTPLRSFMSDSGSSVNGGVMRAV
VKSPIMCHEKSPSVCSPLNMTSSVCSPAGINSVSSTTASFGSFPVHSPITQGTPLTCSPN
VENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPPSHCSVKSPVSSPNNVTLRSSVSSP
ANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSAGSSTLRDVVP
SPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSD
SSFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGF
DGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSAR
DQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS
KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRL
QKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVN
TALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQV
VKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKM
HQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYI
KELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAML
VEIISDQLPKVESGNAKPLYFHRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50444204
n/a
NameBDBM50444204
Synonyms:CHEMBL3093462
TypeSmall organic molecule
Emp. Form.C19H21Cl2N3O2S
Mol. Mass.426.36
SMILESCC[C@@H](Cn1cc(C)c2ccccc12)NS(=O)(=O)c1c(N)cc(Cl)cc1Cl |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: