| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-hydroxyanthranilate 3,4-dioxygenase |
|---|
| Ligand | BDBM50446510 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1287917 (CHEMBL3112336) |
|---|
| IC50 | 1100±n/a nM |
|---|
| Citation |  Vallerini, GP; Amori, L; Beato, C; Tararina, M; Wang, XD; Schwarcz, R; Costantino, G 2-Aminonicotinic acid 1-oxides are chemically stable inhibitors of quinolinic acid synthesis in the mammalian brain: a step toward new antiexcitotoxic agents. J Med Chem56:9482-95 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 3-hydroxyanthranilate 3,4-dioxygenase |
|---|
| Name: | 3-hydroxyanthranilate 3,4-dioxygenase |
|---|
| Synonyms: | 3-HAO | 3-hydroxyanthranilate oxygenase | 3-hydroxyanthranilic acid dioxygenase | 3HAO_HUMAN | HAAO | HAD |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32552.73 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_108017 |
|---|
| Residue: | 286 |
|---|
| Sequence: | MERRLGVRAWVKENRGSFQPPVCNKLMHQEQLKVMFIGGPNTRKDYHIEEGEEVFYQLEG
DMVLRVLEQGKHRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYV
GDTMDVLFEKWFYCKDLGTQLAPIIQEFFSSEQYRTGKPIPDQLLKEPPFPLSTRSIMEP
MSLDAWLDSHHRELQAGTPLSLFGDTYETQVIAYGQGSSEGLRQNVDVWLWQLEGSSVVT
MGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDPACKKPLG
|
|
|
|---|
| BDBM50446510 |
|---|
| n/a |
|---|
| Name | BDBM50446510 |
|---|
| Synonyms: | CHEMBL3110069 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C7H8N2O3 |
|---|
| Mol. Mass. | 168.15 |
|---|
| SMILES | Cc1ccc(C(O)=O)c(N)[n+]1[O-] |
|---|
| Structure | 
|
|---|
Search and Browse
