Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHypoxia-inducible factor prolyl hydroxylase 1
LigandBDBM50385806
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1290292
IC50 0.200000±n/a nM
Citation Rabinowitz MH Inhibition of hypoxia-inducible factor prolyl hydroxylase domain oxygen sensors: tricking the body into mounting orchestrated survival and repair responses. J Med Chem 56:9369-402 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hypoxia-inducible factor prolyl hydroxylase 1
Name:Hypoxia-inducible factor prolyl hydroxylase
Synonyms:Egl nine homolog 2 | Estrogen-induced tag 6 | HIF prolyl hydroxylase | HIF-PH1 | HIF-prolyl hydroxylase 1 | HPH-3 | PHD1 | Prolyl hydroxylase domain-containing protein 1 | Prolyl hydroxylase domain-containing protein 1 (PHD1)
Type:Protein
Mol. Mass.:43657.01
Organism:Homo sapiens (Human)
Description:Q96KS0
Residue:407
Sequence:
MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAG
SGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRK
WAEDGGDAPSPSKRPWARQENQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALD
YIVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQI
AWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDN
PHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEV
KPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50385806
n/a
NameBDBM50385806
Synonyms:CHEMBL2041193
TypeSmall organic molecule
Emp. Form.C32H30N6O4
Mol. Mass.562.6184
SMILESCc1cccnc1CN1CCC2(CC1)N(C(=O)N(C2=O)c1ccc(cc1)-c1ccc(cc1C)C(O)=O)c1ccncn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: