Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor protein alpha-2/beta-2 subunit
LigandBDBM50452055
Substrate/Competitorn/a
Meas. Tech.ChEMBL_143225
Ki 7.5±n/a nM
Citation Wei ZLXiao YKellar KJKozikowski AP Synthesis and pharmacological characterization of bivalent ligands of epibatidine at neuronal nicotinic acetylcholine receptors. Bioorg Med Chem Lett 14:1855-8 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor protein alpha-2/beta-2 subunit
Name:Neuronal acetylcholine receptor protein alpha-2/beta-2 subunit
Synonyms:Neuronal acetylcholine receptor; alpha2/beta2 | nAChR subtypes alpha2 beta2
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 143226
Components:This complex has 2 components.
Component 1
Name:Neuronal acetylcholine receptor subunit alpha-2
Synonyms:Cholinergic, Nicotinic Alpha2Beta2 | Cholinergic, Nicotinic Alpha2Beta4
Type:Enzyme
Mol. Mass.:58597.25
Organism:Rattus norvegicus (Rat)
Description:P12389
Residue:511
Sequence:
MTLSHSALQFWTHLYLWCLLLVPAVLTQQGSHTHAEDRLFKHLFGGYNRWARPVPNTSDV
VIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNVTSLRVPSEMIWIP
DIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGS
WTYDKAKIDLEQMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRR
LPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSL
VIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMMNRP
LPPMELHGSPDLKLSPSYHWLETNMDAGEREETEEEEEEEDENICVCAGLPDSSMGVLYG
HGGLHLRAMEPETKTPSQASEILLSPQIQKALEGVHYIADRLRSEDADSSVKEDWKYVAM
VVDRIFLWLFIIVCFLGTIGLFLPPFLAGMI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Nicotinic acetylcholine receptor alpha6/alpha3/beta2/beta3
Synonyms:N-alpha 1 | Neuronal acetylcholine receptor | Neuronal acetylcholine receptor non-alpha-1 chain | Neuronal acetylcholine receptor subunit beta-2
Type:Enzyme
Mol. Mass.:56910.32
Organism:Rattus norvegicus (Rat)
Description:P12390
Residue:500
Sequence:
MAGHSNSMALFSFSLLWLCSGVLGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLM
VSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYN
NADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRT
EIDLVLKSDVASLDDFTPSGEWDIIALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINL
IIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYL
MFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPTLLFLQQPRHRCARQRL
RLRRRQREREGAGALFFREGPAADPCTCFVNPASVQGLAGAFRAEPTAAGPGRSVGPCSC
GLREAVDGVRFIADHMRSEDDDQSVREDWKYVAMVIDRLFLWIFVFVCVFGTVGMFLQPL
FQNYTATTFLHPDHSAPSSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50452055
n/a
NameBDBM50452055
Synonyms:CHEMBL56045
TypeSmall organic molecule
Emp. Form.C32H44Cl2N4
Mol. Mass.555.625
SMILESClc1ccc(cn1)C1CC2CCC1N2CCCCCCCCCCN1C2CCC1C(C2)c1ccc(Cl)nc1 |TLB:14:13:7.8:11.10,31:29:24:27.26,THB:23:24:29.30:27.26,4:7:13:11.10|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: