Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 1
LigandBDBM50084563
Substrate/Competitorn/a
Meas. Tech.ChEMBL_956004
Ki 185±n/a nM
Citation Vullo DLuca VDScozzafava ACarginale VRossi MSupuran CTCapasso C The alpha-carbonic anhydrase from the thermophilic bacterium Sulfurihydrogenibium yellowstonense YO3AOP1 is highly susceptible to inhibition by sulfonamides. Bioorg Med Chem 21:1534-8 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 1
Name:Carbonic anhydrase
Synonyms:CA-I | CAB | Carbonate dehydratase I | Carbonic anhydrase 1 (CA I) | Carbonic anhydrase 1 (CA-I) | Carbonic anhydrase 1 (Recombinant CA I) | Carbonic anhydrase 2 (CA II) | Carbonic anhydrase B | Carbonic anhydrase I (CA I) | Carbonic anhydrase I (CA-I) | Carbonic anhydrase I (CAI) | Carbonic anhydrase I (hCA I) | Carbonic anhydrase isoenzyme I (hCA I) | hCA
Type:Enzyme
Mol. Mass.:28873.37
Organism:Homo sapiens (Human)
Description:P00915
Residue:261
Sequence:
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50084563
n/a
NameBDBM50084563
Synonyms:5-(4-Amino-benzenesulfonylimino)-4-methyl-4,5-dihydro-[1,3,4]thiadiazole-2-sulfonic acid amide | 5-[(E)-4-Amino-benzenesulfonylimino]-4-methyl-4,5-dihydro-[1,3,4]thiadiazole-2-sulfonic acid amide | 5-[4-Amino-benzenesulfonylimino]-4-methyl-4,5-dihydro-[1,3,4]thiadiazole-2-sulfonic acid amide | CHEMBL13630
TypeSmall organic molecule
Emp. Form.C9H11N5O4S3
Mol. Mass.349.41
SMILESCn1nc(s\c1=N\S(=O)(=O)c1ccc(N)cc1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: